HNF1A antibody

• Catalog Number: orb583768
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNF1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: HNF1A
• UniProt ID: P20823
• Protein Sequence: Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
• NCBI: NP_000536
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDD
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: HNF1A, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HNF1A, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: HNF1A, Sample Type: Human Fetal Stomach, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Liver Carcinoma (HepG2 lysate) 10-40 ug lysate/lane, Primary dilution: 1:1000, Secondary: Alexa Fluor 680 Donkey Anti-Rabbit IgG Invitrogen, Secondary dilution: 1:30000. HNF1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

WB Suggested Anti-HNF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human kidney.