You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581369 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HNF1A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 67kDa |
Target | HNF1A |
UniProt ID | P20823 |
Protein Sequence | Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
NCBI | NP_000536 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDD Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
Human Liver
Human Lung
WB Suggested Anti-HNF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: OVCAR-3 cell lysate. HNF1A is supported by BioGPS gene expression data to be expressed in OVCAR3.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IHC-P, WB | |
Bovine, Canine, Gallus, Porcine, Sheep, Zebrafish | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating