HMOX1 antibody

• Catalog Number: orb579414
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HMOX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Goat, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMOX1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: HMOX1
• UniProt ID: P09601
• Protein Sequence: Synthetic peptide located within the following region: ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
• NCBI: NP_002124
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HO-1, HSP32, HMOX1D, bK286B10
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HMOX1 antibody - N-terminal region (orb579414) validated by WB using tonsil and fibroblast at 1:1000.

Host: Mouse, Target Name: HMOX1, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: HMOX1, Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: HMOX1, Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-HMOX1 Antibody, Catalog Number: orb579414, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.