You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580448 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HMGCS1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HMGCS1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 57 kDa |
Target | HMGCS1 |
UniProt ID | Q01581 |
Protein Sequence | Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA |
NCBI | NP_002121 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HMGCS Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Isoforms containing the peptide sequence are found at ~53 kDa and ~36 kDa.
Host: Rabbit, Target: HMGCS1, Positive control (+): THP-1 (N30), Negative control (-): HeLa (HL), Antibody concentration: 3 ug/ml.
Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HMGCS1 antibody (orb580448).
WB Suggested Anti-HMGCS1 Antibody Titration: 1 ug/ml, Positive Control: 293T cells lysate. HMGCS1 is supported by BioGPS gene expression data to be expressed in HEK293T.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Gallus, Hamster, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating