Cart summary

You have no items in your shopping cart.

    HMGB2 Antibody

    Catalog Number: orb371736

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb371736
    CategoryAntibodies
    DescriptionHMGB2 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2 (65-97aa KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW24034 MW
    UniProt IDP26583
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHigh mobility group protein B2;High mobility group
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    HMGB2 Antibody

    Flow Cytometry analysis of A431 cells using anti-HMGB2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    HMGB2 Antibody

    WB analysis of HMGB2 using anti-HMGB2 antibody.Lane 1:human Jurkat cell;2:rat PC-12 cell;3:mouse spleen tissue.

    HMGB2 Antibody

    IF analysis of HMGB2 using anti-HMGB2 antibody.HMGB2 was detected in immunocytochemical section of U20S cells.

    HMGB2 Antibody

    IF analysis of HMGB2 and Tubulin alpha using anti-HMGB2 antibody and anti-Tubulin alpha antibody. HMGB2 and Tubulin alpha were detected in immunocytochemical section of MCF-7 cells.

    HMGB2 Antibody

    IF analysis of HMGB2 using anti-HMGB2 antibody. HMGB2 was detected in a paraffin-embedded section of rat intestine tissue.

    HMGB2 Antibody

    IHC analysis of HMGB2 using anti-HMGB2 antibody. HMGB2 was detected in a paraffin-embedded section of mouse intestine tissue.

    HMGB2 Antibody

    IHC analysis of HMGB2 using anti-HMGB2 antibody. HMGB2 was detected in a paraffin-embedded section of rat spleen tissue.

    HMGB2 Antibody

    IHC analysis of HMGB2 using anti-HMGB2 antibody. HMGB2 was detected in a paraffin-embedded section of human intestinal cancer tissue.

    • HMGB2 Antibody [orb1563808]

      ICC,  IHC-Fr,  IHC-P,  IP,  WB

      Hamster, Human, Mouse, Rat

      Rabbit

      Monoclonal

      Unconjugated

      100 μl, 50 μl, 20 μl
    • HMGB2 antibody [orb318774]

      IF,  IH,  WB

      Human, Mouse

      Rabbit

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 30 μl
    • HMGB2 antibody [orb583895]

      IHC,  WB

      Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • HMGB2 antibody [orb573974]

      IHC,  WB

      Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

      Human

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • HMGB2 Antibody [orb1243966]

      ELISA,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars