Cart summary

You have no items in your shopping cart.

    HMGB1 Antibody

    Catalog Number: orb389479

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb389479
    CategoryAntibodies
    DescriptionHMGB1 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW24894 MW
    UniProt IDP09429
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHigh mobility group protein B1;High mobility group
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    HMGB1 Antibody

    Flow Cytometry analysis of THP-1 cells using anti-HMGB1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    HMGB1 Antibody

    WB analysis of HMGB1 using anti-HMGB1 antibody.Lane 1:human HeLa cell;2:human 293T cell;3:human K562 cell;4:human Jurkat cell;5:rat brain tissue;6:mouse brain tissue.

    HMGB1 Antibody

    IF analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in immunocytochemical section of U20S cells.

    HMGB1 Antibody

    IF analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in immunocytochemical section of A431 cells.

    HMGB1 Antibody

    IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of mouse intestine tissues.

    HMGB1 Antibody

    IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of mouse liver tissues.

    HMGB1 Antibody

    IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of rat intestine tissues.

    HMGB1 Antibody

    IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of rat liver tissues.

    HMGB1 Antibody

    IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of human mammary cancer tissues.

    HMGB1 Antibody

    IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of human placenta tissues.

    • HMGB1 antibody [orb195321]

      ELISA,  ICC,  IF,  IHC-P,  WB

      Bovine, Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 200 μg
    • HMGB1 antibody [orb135662]

      IHC,  WB

      Human, Mouse, Rat

      Polyclonal

      Unconjugated

      200 μl, 100 μl, 50 μl
    • HMGB1 Antibody (monoclonal, 5H3) [orb570317]

      FC,  IHC,  WB

      Human, Monkey, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    • HMGB1 Antibody [orb1239440]

      ELISA,  IF,  IHC-P,  WB

      Gallus, Porcine

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      0.1 mg, 0.02 mg
    • HMGB1 Antibody [orb1274463]

      IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars