Cart summary

You have no items in your shopping cart.

    HMG4/HMGB3 Antibody

    Catalog Number: orb315141

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb315141
    CategoryAntibodies
    DescriptionHMG4/HMGB3 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW22980 MW
    UniProt IDO15347
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHigh mobility group protein B3;High mobility group
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    HMG4/HMGB3 Antibody

    Flow Cytometry analysis of HL-60 cells using anti-HMG4 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    HMG4/HMGB3 Antibody

    WB analysis of HMG4 using anti-HMG4 antibody.Lane 1:Mouse Liver Tissue;2:Mouse Kidney Tissue;3:Mouse Testis Tissue;4:22RV1 Cell;5:MCF-7 Cell;6:NIH3T3 Cell.

    HMG4/HMGB3 Antibody

    IF analysis of HMG4 using anti-HMG4 antibody. HMG4 was detected in immunocytochemical section of MCF-7 cells.

    HMG4/HMGB3 Antibody

    IHC analysis of HMG4 using anti-HMG4 antibody. HMG4 was detected in a paraffin-embedded section of mouse intestine tissue.

    HMG4/HMGB3 Antibody

    IHC analysis of HMG4 using anti-HMG4 antibody. HMG4 was detected in a paraffin-embedded section of rat intestine tissue.

    HMG4/HMGB3 Antibody

    IHC analysis of HMG4 using anti-HMG4 antibody. HMG4 was detected in a paraffin-embedded section of human placenta tissue.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars