HMG4 Antibody (monoclonal, 7G13)

• Catalog Number: orb623776
• Category: Antibodies
• Description: HMG4 Antibody (monoclonal, 7G13)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7G13
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 23 kDa
• UniProt ID: O15347
• Sensitivity: > 5000 cells
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: "chromosomal protein, Nonhistone, HMG4 antibody|Hi
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HeLa cells using anti-HMGB3 antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.

IF analysis of HMGB3 using anti-HMGB3 antibody.

IHC analysis of HMGB3 using anti-HMGB3 antibody.

WB analysis using anti-HMGB3 antibody.Lane 1:placenta tissue, Lane 2:HeLa cell, Lane 3:T-47D cell, Lane 4:A431 cell, Lane 5:HepG2 cell, Lane 6:Caco-2 cell.Lane 7:SW620 cell.Lane 8:Raji cell.