HMBOX1 antibody

• Catalog Number: orb577193
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HMBOX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HMBOX1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: HMBOX1
• UniProt ID: Q6NT76
• Protein Sequence: Synthetic peptide located within the following region: ETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK
• NCBI: NP_078843
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HOT1, TAH1, PBHNF, HNF1LA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: HMBOX1, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-HMBOX1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.