You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577193 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HMBOX1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HMBOX1 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | HMBOX1 |
UniProt ID | Q6NT76 |
Protein Sequence | Synthetic peptide located within the following region: ETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK |
NCBI | NP_078843 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HOT1, TAH1, PBHNF, HNF1LA Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: HMBOX1, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-HMBOX1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
Filter by Rating