HIPK2 antibody

• Catalog Number: orb574278
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HIPK2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 120kDa
• Target: HIPK2
• UniProt ID: Q9H2X6
• Protein Sequence: Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
• NCBI: NP_073577
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PRO0593
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HIPK2 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb574278 with 1:200 dilution. Western blot was performed using orb574278 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: HIPK2 IP with orb574278 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Host: Mouse, Target Name: HIPK2, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: HIPK2, Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: HIPK2, Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 1.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 6%-18%. HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.

Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Nuclear in pinealocytes & intersticial cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-HIPK2 Antibody, Catalog Number: orb574278, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-HIPK2 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HIPK2 Antibody Titration: 0.06 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate, HIPK2 is supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-HIPK2 Antibody Titration: 0.1 ug/ml, Positive Control: Jurkat cell lysate.