You have no items in your shopping cart.
Cart summary
HIGD2A Peptide - N-terminal region
Catalog Number: orb2002935
| Catalog Number | orb2002935 |
|---|---|
| Category | Proteins |
| Description | This is a synthetic peptide designed for use in combination with anti-HIGD2A Antibody (ARP70538_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Tested applications | WB |
| Form/Appearance | Lyophilized powder |
| MW | 11kDa |
| UniProt ID | Q9BW72 |
| Protein Sequence | Synthetic peptide located within the following region: EGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGN |
| NCBI | NP_620175 |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Buffer/Preservatives | Lyophilized powder |
| Alternative names | HIGD2A, Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
