HIF1A antibody

• Catalog Number: orb576507
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HIF1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat
• Reactivity: Gallus, Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HIF1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 93kDa
• Target: HIF1A
• UniProt ID: Q16665
• Protein Sequence: Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA
• NCBI: NP_001521
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HIF1, MOP1, PASD8, HIF-1A, bHLHe78, HIF-1alpha, HI
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

HIF1A antibody - middle region (orb576507) validated by WB using chicken liver.

HIF1A antibody - middle region (orb576507) validated by WB using CoCl2 at 1:500.

Host: Mouse, Target Name: HIF1A, Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Lanes: Lane 1: 80 ug Chicken liver (nuclei), Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IgG, Secondary Antibody Dilution: 1:2000, Gene Name: HIF1A.

WB Suggested Anti-HIF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.