HGF Rabbit Polyclonal Antibody

• Catalog Number: orb579133
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HGF
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 83 kDa
• Target: HGF
• UniProt ID: P14210
• Protein Sequence: Synthetic peptide located within the following region: GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG
• NCBI: NP_000592
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SF, HGFB, HPTA, F-TCF, DFNB39
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

FC Dinau, CM González-Zambrano, JJ Jimenez, LMM Florez, R Oliveira, N Sousa Exploring the dynamics of IL-6, TGF-β1, and CD8+ T cells in the canine transmissible venereal tumor: new perspectives pvj.com.pk, (2025)

PubMed:

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-HGF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

WB Suggested Anti-HGF antibody Titration: 1 ug/ml, Sample Type: Human Liver.