You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291330 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant HEY1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F10 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG |
NCBI | NP_036390 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged HEY1 is approximately 0.1 ng/ml as a capture antibody.
Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M02), clone 2F10. Lane 1: HEY1 transfected lysate(32.613 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).
Filter by Rating