HDAC9 antibody

• Catalog Number: orb578600
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HDAC9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ChIP, IHC, WB
• Predicted Reactivity: Guinea pig, Mouse, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HDAC9
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 65 kDa
• Target: HDAC9
• UniProt ID: Q9UKV0
• Protein Sequence: Synthetic peptide located within the following region: QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
• NCBI: NP_055522
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HD7, HD9, HD7b, HDAC, HDRP, MITR, HDAC7, HDAC7B, H
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The c-terminal peptide used to generate this antibody is not present in the full length canonical isoform, but is present in several HDAC9 isoforms below 654 amino acids. In these samples, isoform 8 of 65 kDa is recognized as well as possibly isoform 11 at 57 kDa.

Chromatin Immunoprecipitation (ChIP) Using HDAC9 antibody - C-terminal region (orb578600) and HCT116 Cells.

Host: Rabbit, Target Name: HDAC9, Sample Tissue: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Human kidney

Rabbit Anti-HDAC9 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HDAC9 Antibody Titration: 1.25 ug/ml, Positive Control: A172 cell lysate. HDAC9 is supported by BioGPS gene expression data to be expressed in A172.