You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574130 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Hdac6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Guinea pig, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Rat |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 125kDa |
Target | Hdac6 |
UniProt ID | Q9UBN7 |
Protein Sequence | Synthetic peptide located within the following region: RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ |
NCBI | XP_228753 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Hdac6 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: HDAC6, Sample Tissue: Mouse Testis, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: HDAC6, Sample Tissue: Mouse Testis, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: HDAC6, Sample Tissue: Mouse Testis, Antibody dilution: 3 ug/ml.
Rabbit Anti-Hdac6 Antibody, Catalog Number: orb574130, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Testis
WB Suggested Anti-Hdac6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Liver.
ChIP, IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating