Hdac6 antibody

• Catalog Number: orb574130
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Hdac6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Guinea pig, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 125kDa
• Target: Hdac6
• UniProt ID: Q9UBN7
• Protein Sequence: Synthetic peptide located within the following region: RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ
• NCBI: XP_228753
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Hdac6
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: HDAC6, Sample Tissue: Mouse Testis, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: HDAC6, Sample Tissue: Mouse Testis, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: HDAC6, Sample Tissue: Mouse Testis, Antibody dilution: 3 ug/ml.

Rabbit Anti-Hdac6 Antibody, Catalog Number: orb574130, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Testis

WB Suggested Anti-Hdac6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Liver.