HCLS1 antibody

• Catalog Number: orb573966
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HCLS1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HCLS1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54kDa
• Target: HCLS1
• UniProt ID: P14317
• Protein Sequence: Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
• NCBI: NP_005326
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HS1, p75, CTTNL, lckBP1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: HCLS1, Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-HCLS1 Antibody, Paraffin Embedded Tissue: Human Stomach, Cellular Data: Epithelial cells of Fundic Gland, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-HCLS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-HCLS1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate, HCLS1 is supported by BioGPS gene expression data to be expressed in Jurkat.