You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578390 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HBZ |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HBZ |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 16kDa |
Target | HBZ |
UniProt ID | P02008 |
Protein Sequence | Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA |
NCBI | NP_005323 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HBAZ, HBZ1, HBZ-T1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-HBZ Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hemopoietic, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-HBZ Antibody Titration: 1.25 ug/ml, Positive Control: K562 cell lysate. HBZ is supported by BioGPS gene expression data to be expressed in K562.
Filter by Rating