You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330665 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HAX1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HAX1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31kDa |
Target | HAX1 |
UniProt ID | O00165 |
Protein Sequence | Synthetic peptide located within the following region: LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP |
NCBI | NP_006109 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HCLSBP1 antibody, anti HS1BP1 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: HAX1, Sample Tissue: Mouse Skeletal Muscle, Antibody dilution: 1 ug/ml.
Rabbit Anti-HAX1 Antibody, Catalog Number: orb330665, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-HAX1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate, HAX1 is supported by BioGPS gene expression data to be expressed in COLO205.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating