HAL antibody

• Catalog Number: orb325224
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HAL
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HAL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 73 kDa
• Target: HAL
• UniProt ID: P42357
• Protein Sequence: Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET
• NCBI: NP_002099
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HIS antibody, anti HSTD antibody, anti histid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~65 kDa.

Host: Rabbit, Target: HAL, Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 3 ug/mL.

Immunohistochemistry with Fetal liver cell lysate tissue at an antibody concentration of 1.25 ug/mL using anti-HAL antibody (orb325224).

WB Suggested Anti-HAL Antibody Titration: 1 ug/mL, Positive Control: 721_B cell lysate.