You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583944 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to H2AFY |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human H2AFY |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40 kDa |
Target | H2AFY |
UniProt ID | O75367 |
Protein Sequence | Synthetic peptide located within the following region: HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV |
NCBI | NP_001035248 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms between 38 kDa and 40 kDa. Multiply modified by various post translational.
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. MacroH2A.1 has many splice isoforms ranging from ~18 kDa to the canonical isoform at 40 kDa.
Host: Rabbit, Target Name: H2AFY, Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. H2AFY is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.
WB Suggested Anti-H2AFY Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: MCF7 cell lysate.
IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating