You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215825 |
---|---|
Category | Proteins |
Description | The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 5.6 kDa |
Target | TGF alpha |
Entrez | 102005158 |
Protein Sequence | VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA |
Protein Length | 50 |
Source | Yeast |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating