You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578232 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GSTM2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 26kDa |
Target | GSTM2 |
UniProt ID | P28161 |
Protein Sequence | Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF |
NCBI | NP_000839 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GST4, GSTM, GTHMUS, GSTM2-2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0 ug/ml using anti-GSTM2 antibody (orb578232).
Rabbit Anti-GSTM2 Antibody, Paraffin Embedded Tissue: Human Muscle, Cellular Data: Skeletal muscle cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-GSTM2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
FACS, IF, IHC-P, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating