Cart summary

You have no items in your shopping cart.

    GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody

    Catalog Number: orb315135

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb315135
    CategoryAntibodies
    DescriptionGSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIF, IHC, WB
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW25722 MW
    UniProt IDP08263
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesGlutathione S-transferase A1; 2.5.1.18; GST HA sub
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody

    WB analysis of GSTA1/A2/A3/A4/A5 using anti-GSTA1/A2/A3/A4/A5 antibody.Lane 1:human HCCT tissue; 2:human HCCP tissue; 3:rat liver tissue; 4:rat RH35 cell; 5:mouse liver tissue.

    GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody

    IF analysis of GSTA1/A2/A3/A4/A5 using anti-GSTA1/A2/A3/A4/A5 antibody.GSTA1/A2/A3/A4/A5 was detected in paraffin-embedded section of mouse liver tissues.

    GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody

    IF analysis of GSTA1/A2/A3/A4/A5 using anti-GSTA1/A2/A3/A4/A5 antibody.GSTA1/A2/A3/A4/A5 was detected in paraffin-embedded section of rat liver tissues.

    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars