You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582295 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GSR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Reactivity | Human, Mouse, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GSR |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | GSR |
UniProt ID | P00390 |
Protein Sequence | Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
NCBI | NP_000628 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GR, GSRD, HEL-75, HEL-S-122m Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: CHAD, Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: EGFL8, Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in HepG2.
Host: Rabbit, Target Name: FAM46C, Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: GSR, Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NSUN6, Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: WT1, Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in 721_B.
Lanes: 1: 40 ug mouse heart lysate, 2: 40 ug mouse skeletal muscle lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GSR.
Rabbit Anti-GSR Antibody, Catalog Number: orb582295, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-GSR Antibody, Positive Control: Lane 1: 10 ug untreated zebrafish head lysate, Lane 2: 10 ug 3hr H2O2 treated zebrafish head lysate, Lane 3: 10 ug 6hr H2O2 treated zebrafish head lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:10000.
WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.
Filter by Rating