GSK3B antibody

• Catalog Number: orb330768
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GSK3B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GSK3B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 48kDa
• Target: GSK3B
• UniProt ID: P49841
• Protein Sequence: Synthetic peptide located within the following region: AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF
• NCBI: NP_002084
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of 721_B cell lysate tissue using GSK3B antibody

Immunohistochemical staining of human brain tissue using GSK3B antibody

Western blot analysis of human Fetal Heart tissue using GSK3B antibody

Western blot analysis of human Hela tissue using GSK3B antibody

Brain, cortex.

Host: Mouse, Target Name: GSK3B, Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: GSK3B, Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: GSK3B, Sample Type: Hela, Antibody dilution: 1.0 ug/ml. GSK3B is supported by BioGPS gene expression data to be expressed in HeLa.

Host: Rabbit, Target Name: GSK3B, Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-GSK3B Antibody, Catalog Number: orb330768, Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue, Observed Staining: Cytoplasm, Nucleus, Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GSK3B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, GSK3B is supported by BioGPS gene expression data to be expressed in 721_B.