GRSF1 antibody

• Catalog Number: orb324854
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRSF1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRSF1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: GRSF1
• UniProt ID: Q12849
• Protein Sequence: Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
• NCBI: NP_002083
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ13125 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

GRSF1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb324854 with 1:200 dilution. Western blot was performed using orb324854 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: GRSF1 IP with orb324854 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Host: Rabbit, Target Name: GRSF1, Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GRSF1, Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Host: Rabbit, Target Name: GRSF1, Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.