GRN antibody

• Catalog Number: orb330767
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GRN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64 kDa
• Target: GRN
• UniProt ID: P28799
• Protein Sequence: Synthetic peptide located within the following region: QAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQAL
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti GRN antibody, anti antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 62 kDa isoform is identified, and a second isoform of 52 kDa is also present in some samples.

50 ug of HEK293T WT and GRN KO lysates were subjected to SDS-PAGE followed by immunoblotting with an antibody dilution of 1/5000. The second image shows Ponceau S staining of the transferred blot as a loading control experiment.

Host: Rabbit, Target Name: GRN, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: GRN, Sample Type: 721_B Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Immunoprecipitation was performed on concentrated culture media from Brefeldin A treated HEK293T cells using 1.0 μg of the antibody pre-coupled to either protein G or protein A magnetic beads. Samples were washed and processed for immunoblot with an alternate GRN antibody at 1/1000. The Ponceau stained transfers of each blot are shown. SM=10% starting material; UB=10% unbound fraction; IP=immunoprecipitate.