GRN antibody

• Catalog Number: orb330766
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRN
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GRN
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: GRN
• UniProt ID: P28799
• Protein Sequence: Synthetic peptide located within the following region: CPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD
• NCBI: NP_002078
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CLN11 antibody, anti GEP antibody, anti GP88
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 62 kDa isoform is identified, and a second isoform of 47 kDa, and a third isoform of 44 kDa are also present in some samples.

Host: Rabbit, Target Name: GRN, Sample Type: Thyroid Tumor lysates, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target: GRN, Positive control (+): Human Lymph Node (LN), Negative control (-): Human Pancreas (PA), Antibody concentration: 1 ug/ml.

Rabbit Anti-GRN Antibody, Catalog Number: orb330766, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.