You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582463 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GRK5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRK5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 68kDa |
Target | GRK5 |
UniProt ID | P34947 |
Protein Sequence | Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG |
NCBI | NP_005299 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GPRK5, FP2025 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
GRK5 antibody - middle region (orb582463), Catalog Number: orb582463, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of alveolar macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Host: Mouse, Target Name: GRK5, Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.
Lanes: Lane 1: 1 ug human GRK5 protein, Lane 2: 0.25 ug human GRK5 protein, Lane 3: 0.1 ug human GRK5 protein, Lane 4: 5 ug rat striatum homogenate, Lane 5: 5 ug rat striatum cytosol, Lane 6: 5 ug rat striatum light membrane fraction, Lane 7: 5 ug rat striatum synaptic membrane fraction, Lane 8: 5 ug rat striatum crude synaptic vesicle fraction, Lane 9: 5 ug rat striatum homogenate, Lane 10: 5 ug rat striatum cytosol, Lane 11: 5 ug rat striatum light membrane fraction, Lane 12: 5 ug rat striatum synaptic membrane fraction, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:15000, Gene Name: GRK5.
Lanes: Lanes 1-3: 40 ug tobacco hornworm larvae intestine lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GRK5.
Sample Type: Lane 1: 20 ug mouse left ventricle heart lysate Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:5000 Color/Signal Descriptions: GRK5.
WB Suggested Anti-GRK5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating