GRK5 antibody

• Catalog Number: orb582463
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRK5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GRK5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68kDa
• Target: GRK5
• UniProt ID: P34947
• Protein Sequence: Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG
• NCBI: NP_005299
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GPRK5, FP2025
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

GRK5 antibody - middle region (orb582463), Catalog Number: orb582463, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm and membrane of alveolar macrophages, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Host: Mouse, Target Name: GRK5, Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 1 ug human GRK5 protein, Lane 2: 0.25 ug human GRK5 protein, Lane 3: 0.1 ug human GRK5 protein, Lane 4: 5 ug rat striatum homogenate, Lane 5: 5 ug rat striatum cytosol, Lane 6: 5 ug rat striatum light membrane fraction, Lane 7: 5 ug rat striatum synaptic membrane fraction, Lane 8: 5 ug rat striatum crude synaptic vesicle fraction, Lane 9: 5 ug rat striatum homogenate, Lane 10: 5 ug rat striatum cytosol, Lane 11: 5 ug rat striatum light membrane fraction, Lane 12: 5 ug rat striatum synaptic membrane fraction, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:15000, Gene Name: GRK5.

Lanes: Lanes 1-3: 40 ug tobacco hornworm larvae intestine lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GRK5.

Sample Type: Lane 1: 20 ug mouse left ventricle heart lysate Primary Antibody dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:5000 Color/Signal Descriptions: GRK5.

WB Suggested Anti-GRK5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.