You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316571 |
---|---|
Category | Antibodies |
Description | GRK5 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 67787 MW |
UniProt ID | P34947 |
Sensitivity | > 5000 cells |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | G protein-coupled receptor kinase 5;2.7.11.16;G pr Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of GRK5 using anti-GRK5 antibody.Lane 1:human HepG2 cell;2:human HeLa cell;3:human A549 cell;4:rat heart tissue;5:mouse heart tissue.
IHC analysis of GRK5 using anti-GRK5 antibody. GRK5 was detected in a paraffin-embedded section of rat cardiac muscle tissue.
IHC analysis of GRK5 using anti-GRK5 antibody. GRK5 was detected in a paraffin-embedded section of mouse lung tissue.
IHC analysis of GRK5 using anti-GRK5 antibody. GRK5 was detected in a paraffin-embedded section of human placenta tissue.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating