You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402466 |
---|---|
Category | Antibodies |
Description | GRK2/GRK2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 79 kDa |
UniProt ID | P25098 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Beta-adrenergic receptor kinase 1; Beta-ARK-1; G-p Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of U87 cells using anti-GRK2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of GRK2 using anti-GRK2 antibody.Lane 1:rat spleen tissue;2:rat stomach tissue;3:mouse lung tissue;4:mouse liver tissue;5:mouse pancreas tissue.
IF analysis of GRK2 using anti-GRK2 antibody. GRK2 was detected in immunocytochemical section of U20S cells.
IHC analysis of GRK2 using anti-GRK2 antibody.GRK2 was detected in paraffin-embedded section of human Lung cancer tissues.
IHC analysis of GRK2 using anti-GRK2 antibody.GRK2 was detected in paraffin-embedded section of mouse spleen tissues.
IHC analysis of GRK2 using anti-GRK2 antibody.GRK2 was detected in paraffin-embedded section of rat spleen tissues.
Filter by Rating