Gria3 antibody

• Catalog Number: orb575347
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Gria3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Zebrafish
• Reactivity: Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Gria3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 97kDa
• Target: Gria3
• UniProt ID: P19492
• Protein Sequence: Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM
• NCBI: NP_116785
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GLUR3, GluA3, GluR-3, GluR-C, GluR-K3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Mouse, Target Name: GRIK2, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: Gria3, Sample Type: Rat Stomach lysates, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: GRIK2, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.