You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575347 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Gria3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Zebrafish |
Reactivity | Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Rat Gria3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 97kDa |
Target | Gria3 |
UniProt ID | P19492 |
Protein Sequence | Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM |
NCBI | NP_116785 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GLUR3, GluA3, GluR-3, GluR-C, GluR-K3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: GRIK2, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: Gria3, Sample Type: Rat Stomach lysates, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: GRIK2, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating