GRHL2 antibody

• Catalog Number: orb574752
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GRHL2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GRHL2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: GRHL2
• UniProt ID: Q6ISB3
• Protein Sequence: Synthetic peptide located within the following region: IPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPDSTFSETFKE
• NCBI: NP_079191.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BOM, ECTDS, PPCD4, DFNA28, TFCP2L3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: GRHL1, Sample Type: Lung tumor lysates, Antibody dilution: 1.0 ug/ml.

Rabbit Anti-GRHL2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Skin, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.