You have no items in your shopping cart.
Cart summary
GRF, porcine
Catalog Number: orb2694660
| Catalog Number | orb2694660 |
|---|---|
| Category | Proteins |
| Description | GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release of growth hormone. |
| CAS Number | 88384-73-0 |
| Purity | ≥95% |
| MW | 5108.86 |
| Formula | C219H365N73O66S |
| Target | GHSR |
| Protein Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
