You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584010 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GRB2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | GRB2 |
UniProt ID | P62993 |
Protein Sequence | Synthetic peptide located within the following region: AKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIE |
NCBI | NP_002077 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ASH, Grb3-3, MST084, NCKAP2, MSTP084, EGFRBP-GRB2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.
GRB2 antibody - N-terminal region (orb584010) validated by WB using 1. and 2. Human Cystic Fibrosis Bronchial Epithelial Cells (35 ug) Primary dilution: 1:500, Secondary Anitbody: goat anti-rabbit-HRPSecondary dilution: 1:5000.
GRB2 antibody - N-terminal region (orb584010) validated by WB using 721_B cell Lysate at 1 ug/ml. GRB2 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Mouse, Target Name: GRB2, Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.
Rabbit Anti-GRB2 Antibody, Catalog Number: orb584010, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine | |
Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating