GPSM2 antibody

• Catalog Number: orb330634
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GPSM2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, IHC-P, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GPSM2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 76kDa
• Target: GPSM2
• UniProt ID: P81274
• Protein Sequence: Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
• NCBI: NP_037428
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti LGN antibody, anti Pins antibody, anti PINS a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human placenta tissue using GPSM2 antibody

Immunohistochemical staining of human Liver tissue using GPSM2 antibody

Western blot analysis of human Fetal Liver tissue using GPSM2 antibody

Immunohistochemical staining of human Liver tissue using GPSM2 antibody

Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

GPSM2 antibody - N-terminal region (orb330634) validated by WB using Fetal Liver Lysate at 1 ug/ml.

Host: Rabbit, Target Name: GPSM2, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: GPSM2, Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: GPSM2, Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target: GPSM2, Positive control (+): Human lung (LU), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-GPSM2 Antibody, Paraffin Embedded Tissue: Human Liver, Antibody Concentration: 5 ug/ml.