You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579193 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GPNMB |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GPNMB |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | GPNMB |
UniProt ID | Q14956 |
Protein Sequence | Synthetic peptide located within the following region: DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV |
NCBI | NP_001005340 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | NMB, HGFIN, PLCA3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: GPNMB, Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: GPNMB, Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target: GPNMB, Positive control (+): Human lung (LU), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.
WB Suggested Anti-GPNMB Antibody Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FA, FACS, Kinetics | |
Human | |
Monoclonal | |
Unconjugated |
Filter by Rating