You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586134 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GPM6A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish |
Reactivity | Human, Rat |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 31kDa |
Target | GPM6A |
UniProt ID | P51674 |
Protein Sequence | Synthetic peptide located within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN |
NCBI | NP_005268 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | M6A, GPM6 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: GPM6A, Antibody dilution: 1.0 ug/ml, Sample Type: Human brain.
Host: Rabbit, Target Name: GPM6A, Sample Tissue: Human Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: GPM6A, Positive control (+): Human Liver (LI), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 3 ug/ml.
Lanes: Lane 1: 250 ug rat hippocampal culture neurons, Lane 2: 200 ug rat hippocampal culture neurons, Lane 3: 100 ug rat hippocampal culture neurons, Lane 4: 50 ug rat hippocampal culture neurons, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.
Lanes: Lane 1: 400 ug rat hippocampal, Lane 2: 300 ug rat hippocampal, Lane 3: 200 ug rat hippocampal, Lane 4: 100 ug rat hippocampal, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:8000, Gene Name: GPM6A.
Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A.
Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-AlexaFluor 488, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: GPM6A: Green DAPI: Blue, Gene Name: GPM6A.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating