You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333720 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GP73 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GOLM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45kDa |
Target | GOLM1 |
UniProt ID | Q8NBJ4 |
Protein Sequence | Synthetic peptide located within the following region: RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS |
NCBI | NP_057632 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Golgi membrane protein 1 antibody, anti Golgi Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Hela tissue using GP73 antibody
Western blot analysis of human brain tissue using GP73 antibody
Host: Rabbit, Target Name: GOLM1, Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. GOLM1 is supported by BioGPS gene expression data to be expressed in HeLa.
WB Suggested Anti-GOLM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating