You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579212 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GP2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Equine, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GP2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 59 kDa |
Target | GP2 |
UniProt ID | P55259 |
Protein Sequence | Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES |
NCBI | NP_001007242 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ZAP75 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. The canonical isoform of 59 kDa is present as well as a second isoform around 43 kDa.
Anti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Host: Rabbit, Target Name: GP2, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: GP2, Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GP2 is expressed in HepG2.
Host: Rabbit, Target Name: GP2, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: GP2, Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.
WB Suggested Anti-GP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.
ELISA, IHC-P, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating