You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581343 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GP1BA |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GP1BA |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 72 kDa |
Target | GP1BA |
UniProt ID | P07359 |
Protein Sequence | Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS |
NCBI | NP_000164 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | BSS, GP1B, VWDP, CD42B, GPIbA, BDPLT1, BDPLT3, DBP Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Two isoforms contain this peptide sequence, including the 72 kDa canonical isoform and a 69 kDa alternate isoform. Additionally the full length protein can be processed into two chains of ~70 kDa and ~54 kDa forms.
Host: Rabbit, Target Name: GP1BA, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GP1BA, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 3 ug/ml.
Host: Rabbit, Target Name: GP1BA, Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target: GP1BA, Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 1 ug/ml.
WB Suggested Anti-GP1BA Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IHC-P | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating