You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2056091 |
---|---|
Category | Proteins |
Description | GP Recombinant Protein |
Species/Host | Virus |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 17.4 kDa |
UniProt ID | Q7T9D9 |
Protein Sequence | QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN |
Source | Yeast |
NCBI | YP_138523.1 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | GP1,2;second secreted glycoprotein;small secreted Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Filter by Rating