You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325275 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GOLGB1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGB1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 376 kDa |
Target | GOLGB1 |
UniProt ID | Q14789 |
Protein Sequence | Synthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE |
NCBI | NP_004478 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti GCP antibody, anti GCP372 antibody, anti GIAN Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of 721_B cell lysate tissue using GOLGB1 antibody
Immunohistochemical staining of human Uterus tissue using GOLGB1 antibody
Host: Rabbit, Target Name: GOLGB1, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL.
Host: Rabbit, Target Name: GOLGB1, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 4 ug/mL.
Host: Rabbit, Target Name: GOLGB1, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: GOLGB1, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Host: Rabbit, Target Name: GOLGB1, Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human uterus tissue labelling Giantin with orb325275 at 5 ug/mL.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, GOLGB1 is supported by BioGPS gene expression data to be expressed in 721_B.
ELISA, FC, ICC, IF, IHC, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P | |
Canine, Equine, Hamster, Monkey, Mouse, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating