You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb589425 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNPDA2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human GNPDA2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 30 kDa |
Target | GNPDA2 |
UniProt ID | Q8TDQ7 |
Protein Sequence | Synthetic peptide located within the following region: LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGN |
NCBI | NP_001257809.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GNP2, SB52 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: GNPDA2, Sample Tissue: Human HT1080 Whole Cell lysates, Antibody Dilution: 1 ug/ml.
ELISA, ICC, IF, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating