GNAS antibody

• Catalog Number: orb330253
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNAS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Human, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: GNAS
• UniProt ID: Q5FWY2
• Protein Sequence: Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
• NCBI: NP_536351
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti RP4-543J19.4 antibody, anti AHO antibody, ant
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 lysate tissue using GNAS antibody

Western blot analysis of Jurkat cell lysate tissue using GNAS antibody

Immunohistochemical staining of human kidney tissue using GNAS antibody

Immunohistochemical staining of human Lung tissue using GNAS antibody

Immunohistochemical staining of human Lung tissue using GNAS antibody

Western blot analysis of human Jurkat tissue using GNAS antibody

Western blot analysis of human MCF7 tissue using GNAS antibody

Host: Mouse, Target Name: GNAS, Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: GNAS, Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GNAS, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: NOP56, Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, GNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

Human kidney

Human Lung

Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human Jurkat.

WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human MCF7.

WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: HepG2 lysate. There is BioGPS gene expression data showing that GNAS is expressed in HepG2.

WB Suggested Anti-GNAS Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GNAS is expressed in Jurkat.