GNAS antibody

• Catalog Number: orb330252
• Category: Antibodies
• Description: Rabbit polyclonal antibody to GNAS
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: GNAS
• UniProt ID: P63092
• Protein Sequence: Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
• NCBI: NP_000507
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AHO antibody, anti C20orf45 antibody, anti GN
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of MCF-7 whole cell lysates tissue using GNAS antibody

Immunohistochemical staining of human thyroid tissue using GNAS antibody

Immunohistochemical staining of human Pancreas tissue using GNAS antibody

Western blot analysis of INS1 tissue using GNAS antibody

Western blot analysis of MCF7 Whole Cell tissue using GNAS antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 46 kDa is present as well as a second isoform around 111 kDa.

Anti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

Host: Rabbit, Target Name: GNAS, Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: GNAS, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: GNAS, Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: GNAS, Sample Type: MCF7 Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

Lane 1: INS1 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody Dilution: 1:1000, Gene Name: GNAS.

Rabbit Anti-GNAS Antibody, Paraffin Embedded Tissue: Human Pancreas, Antibody Concentration: 5 ug/mL.

WB Suggested Anti-GNAS Antibody Titration: 1 ug/mL, Positive Control: MCF-7 Whole Cell, lysate, sGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.