You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330201 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNAS |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46kDa |
Target | GNAS |
UniProt ID | P63092 |
Protein Sequence | Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
NCBI | NP_000507 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti AHO antibody, anti C20orf45 antibody, anti GN Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Nthy-ori cell lysate (50 ug), Primary Dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary Dilution: 1:2000.
WB Suggested Anti-GNAS antibody Titration: 1 ug/mL, Sample Type: Human MCF7.
WB Suggested Anti-GNAS Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, There is BioGPS gene expression data showing that GNAS is expressed in Jurkat.
IHC, WB | |
Bovine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating