You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582416 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNAI2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | GNAI2 |
UniProt ID | P04899 |
Protein Sequence | Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA |
NCBI | NP_002061 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Nthy-ori cell lysate (50 ug), Primary dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary dilution: 1:2000.
Host: Mouse, Target Name: GNAI2, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
WB Suggested Anti-GNAI2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.
ICC, IHC-Fr, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Monoclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Mouse, Porcine, Rat | |
Human | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating