You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582414 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to GNAI1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Sheep, Yeast, Zebrafish |
Reactivity | Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GNAI1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | GNAI1 |
UniProt ID | P63096 |
Protein Sequence | Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
NCBI | NP_002060 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Gi Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Nthy-ori cell lysate (50 ug), Primary dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary dilution: 1:2000.
Host: Mouse, Target Name: GNAI1, Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GNAI1, Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: GNAI1, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: GNAI1, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rat, Target Name: GNAI1, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.
WB Suggested Anti-GNAI1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.
ELISA, WB | |
Drosophila, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating